PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000185.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 314aa    MW: 35486.1 Da    PI: 6.7936
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000185.1_g00013.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62.1e-52111391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++k+k     ++ewyfFs++dkky+tg+r+nrat++g+W
  Itr_sc000185.1_g00013.1  11 VPPGFRFHPTEEELLHYYLRKKVASQKIDL-DVIPEVDLNKLEPWDIQEKCKIgstPQNEWYFFSHKDKKYPTGTRTNRATAAGFW 95 
                              69****************************.9***************964444222455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk + s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Itr_sc000185.1_g00013.1  96 KATGRDKVIQS-NCRRIGLRKTLVFYKGRAPRGQKSDWIMHEYRL 139
                              *********99.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-578172IPR003441NAC domain
PROSITE profilePS5100556.05611172IPR003441NAC domain
PfamPF023651.2E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MNLSVNGESQ VPPGFRFHPT EEELLHYYLR KKVASQKIDL DVIPEVDLNK LEPWDIQEKC  60
KIGSTPQNEW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKVIQSNCRR IGLRKTLVFY  120
KGRAPRGQKS DWIMHEYRLD DIITSHDATG TNLVGEMSGP DEGWVICKVF KKKLYHKAAM  180
EYNHNPQTHQ RNDGVLDQIL TYMGKSSSSK HPHAGETKNI LLAAAGENSP PQFLHMPPLE  240
TAVDISHIIP FDDMLADTEP FYPCYDGGAG AGVDFSVDCY GAHPTVDDLR PYDQNQISQV  300
HSTLIMDPLS HLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-5051739169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070696.11e-118PREDICTED: NAC domain-containing protein 43-like
SwissprotQ9LPI71e-102NAC12_ARATH; NAC domain-containing protein 12
SwissprotQ84WP61e-102NAC43_ARATH; NAC domain-containing protein 43
TrEMBLG4V2G11e-115G4V2G1_G
STRINGPGSC0003DMT4000148721e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.13e-93NAC domain containing protein 12